PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0402s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 102aa    MW: 11024.3 Da    PI: 8.3798
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0402s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.57.9e-343591360
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                         +vrY eC+kNhAa++Gg+avDGC+Efm++ g egt++al+CaACgCHRnFHR+ev++e
  Cagra.0402s0060.1.p 35 NVRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTVDALRCAACGCHRNFHRKEVDTE 91
                         79**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-381100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.8E-303588IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.3E-283788IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3623887IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MKKRQMVIKQ RSRNSNTSSS WTTTSSSSSS SAISNVRYVE CQKNHAANIG GYAVDGCREF  60
MAAGVEGTVD ALRCAACGCH RNFHRKEVDT EVVCEYSPPD A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0117651e-135AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence.
GenBankAY0853271e-135AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence.
GenBankBT0248061e-135BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds.
GenBankCP0026841e-135CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303044.17e-71hypothetical protein CARUB_v10021199mg
SwissprotQ9CA513e-71MIF1_ARATH; Mini zinc finger protein 1
TrEMBLR0GJ867e-71R0GJ86_9BRAS; Uncharacterized protein
STRINGAT1G74660.16e-69(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.14e-52mini zinc finger 1